| Product Number |
ARP54805_P050 |
| Product Page |
www.avivasysbio.com/cenpi-antibody-n-terminal-region-arp54805-p050.html |
| Name |
CENPI Antibody - N-terminal region (ARP54805_P050) |
| Protein Size (# AA) |
756 amino acids |
| Molecular Weight |
87kDa |
| NCBI Gene Id |
2491 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Centromere protein I |
| Alias Symbols |
LRPR1, CENP-I, FSHPRH1 |
| Peptide Sequence |
Synthetic peptide located within the following region: SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Izuta,H., (2006) Genes Cells 11 (6), 673-684 |
| Description of Target |
CENPI is involved in the response of gonadal tissues to follicle-stimulating hormone. The gene encoding CENPI is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. The product of this gene is involved in the response of gonadal tissues to follicle-stimulating hormone. This gene is also a potential candidate for human X-linked disorders of gonadal development and gametogenesis. |
| Protein Interactions |
CENPU; CENPM; CENPN; APP; CENPP; CENPO; CENPH; SUMO2; UBC; CENPA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CENPI (ARP54805_P050) antibody |
| Blocking Peptide |
For anti-CENPI (ARP54805_P050) antibody is Catalog # AAP54805 (Previous Catalog # AAPP31609) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CENPI |
| Uniprot ID |
Q92674 |
| Protein Name |
Centromere protein I |
| Sample Type Confirmation |
CENPI is strongly supported by BioGPS gene expression data to be expressed in MCF7 |
| Protein Accession # |
NP_006724 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006733 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CENPI |
| Predicted Species Reactivity |
Human |
| Application |
IF, WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | DNA/ACA
 | Sample Type : DNA/ACA |
| | Image 2 | Human MCF7
 | WB Suggested Anti-CENPI Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysateCENPI is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells |
|
|
