LASP1 Antibody - C-terminal region (ARP54798_P050)

Data Sheet
 
Product Number ARP54798_P050
Product Page https://www.avivasysbio.com/lasp1-antibody-c-terminal-region-arp54798-p050.html
Name LASP1 Antibody - C-terminal region (ARP54798_P050)
Protein Size (# AA) 261 amino acids
Molecular Weight 30kDa
NCBI Gene Id 3927
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name LIM and SH3 protein 1
Alias Symbols MLN50, Lasp-1
Peptide Sequence Synthetic peptide located within the following region: SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Stone,J.L., (2007) Hum. Mol. Genet. 16 (6), 704-715
Description of Target LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.This gene encodes a member of a LIM protein subfamily which is characterized by a LIM motif and a domain of Src homology region 3. This protein functions as an actin-binding protein and possibly in cytoskeletal organization. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions ZBTB9; KRTAP4-2; RHOXF2; LZTS2; SEPT3; THAP1; ZC2HC1A; ARHGEF15; SPRY2; FXR2; TRIP13; TCF4; TRIM27; REL; PSMA3; GOLGA2; SUMO2; UBC; MDFI; CD81; Prkg1; Prkaca; DAZAP2; ATXN1; FN1; ACD; TINF2; POT1; TERF1; Fancc; CDK7; FHL3; PRKG2; PLSCR1; ZYX; PRKAR2B; ACT
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LASP1 (ARP54798_P050) antibody
Blocking Peptide For anti-LASP1 (ARP54798_P050) antibody is Catalog # AAP54798 (Previous Catalog # AAPP31602)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human LASP1
Uniprot ID Q14847
Protein Name LIM and SH3 domain protein 1
Sample Type Confirmation

LASP1 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_006139
Purification Affinity Purified
Nucleotide Accession # NM_006148
Tested Species Reactivity Human
Gene Symbol LASP1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human heart
Rabbit Anti-LASP1 Antibody
Catalog Number: ARP54798_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Human HepG2
WB Suggested Anti-LASP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysateLASP1 is supported by BioGPS gene expression data to be expressed in HepG2