| Product Number |
ARP54796_P050 |
| Product Page |
www.avivasysbio.com/dnajb1-antibody-c-terminal-region-arp54796-p050.html |
| Name |
Dnajb1 Antibody - C-terminal region (ARP54796_P050) |
| Protein Size (# AA) |
340 amino acids |
| Molecular Weight |
37kDa |
| NCBI Gene Id |
81489 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
DnaJ (Hsp40) homolog, subfamily B, member 1 |
| Alias Symbols |
Hsp, DjB1, Hdj1, HSPF1, Hsp40, 0610007I11Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: VFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Dnajb1 interacts with HSP70 and can stimulate its ATPase activity. It stimulates the association between HSC70 and HIP. |
| Protein Interactions |
Htt; Atxn3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Dnajb1 (ARP54796_P050) antibody |
| Blocking Peptide |
For anti-Dnajb1 (ARP54796_P050) antibody is Catalog # AAP54796 |
| Uniprot ID |
Q9QYJ3 |
| Protein Name |
DnaJ homolog subfamily B member 1 |
| Protein Accession # |
NP_061278 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018808 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Dnajb1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 85% |
| Image 1 | Mouse Liver
 | WB Suggested Anti-Dnajb1 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Liver |
|
|
