LDHA Antibody - middle region : HRP (ARP54777_P050-HRP)

Data Sheet
 
Product Number ARP54777_P050-HRP
Product Page www.avivasysbio.com/ldha-antibody-middle-region-hrp-arp54777-p050-hrp.html
Name LDHA Antibody - middle region : HRP (ARP54777_P050-HRP)
Gene Symbol LDHA
Alias Symbols LDHM, GSD11, PIG19, HEL-S-133P
Protein Size (# AA) 332 amino acids
Molecular Weight 37kDa
Product Format Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Conjugation HRP
NCBI Gene Id 3939
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Official Gene Full Name lactate dehydrogenase A
Peptide Sequence Synthetic peptide located within the following region: PLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVH
Target Reference Listerman,I., PLoS Genet. 3 (11), E212 (2007)
Description of Target The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Protein Interactions MAPK10; LDHB; FUS; HUWE1; ISG15; UBC; SUMO2; SUMO3; STAU1; RPA3; RPA2; RPA1; ASB9; RNF2; CNDP2; NAGK; C11orf58; NDRG1; BZW1; KYNU; TCEA1; SORD; SMS; RPS6KA1; PGD; PAFAH1B3; GSR; PDIA3; GNAI3; DLD; CSE1L; LDHAL6B; FTO; BCCIP; XRN1; FBXO6; UPF2; YWHAQ; METT
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-LDHA (ARP54777_P050-HRP) antibody
Blocking Peptide For anti-LDHA (ARP54777_P050-HRP) antibody is Catalog # AAP54777 (Previous Catalog # AAPP31572)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LDHA
Complete computational species homology data Anti-LDHA (ARP54777_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LDHA.
Swissprot Id P00338
Protein Name L-lactate dehydrogenase A chain
Sample Type Confirmation

LDHA is supported by BioGPS gene expression data to be expressed in HeLa

Protein Accession # NP_005557
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LDHA.
Nucleotide Accession # NM_005566
Replacement Item This antibody may replace item sc-130327 from Santa Cruz Biotechnology.
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Goat: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 79%; Zebrafish: 92%
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
7700 Ronson Road, Ste 100, San Diego, CA 92111 USA | Tel: (858)552-6979 | info@avivasysbio.com