website statistics
Product Datasheet: ARP54776_P050 - LDHA antibody - N-terminal region (ARP54776_P050) - Aviva Systems Biology
LDHA antibody - N-terminal region (ARP54776_P050)
Data Sheet
Product Number ARP54776_P050
Product Page
Product Name LDHA antibody - N-terminal region (ARP54776_P050)
Gene Symbol LDHA
Protein Size (# AA) 332 amino acids
Molecular Weight 37kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Official Gene Full Name Lactate dehydrogenase A
Alias Symbols LDH-M, LDH1, PIG19, LDHM, GSD11
NCBI Gene Id 3939
Host Rabbit
Clonality Polyclonal
Size 100 ul
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Description This is a rabbit polyclonal antibody against LDHA. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALV
Target Reference Listerman,I., PLoS Genet. 3 (11), E212 (2007)
Description of Target LDHA catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Additional Information IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 2.5 ug/ml.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-LDHA (ARP54776_P050) antibody is Catalog # AAP54776 (Previous Catalog # AAPP31571)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LDHA
Complete computational species homology data Anti-LDHA (ARP54776_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express LDHA.
Swissprot Id P00338
Protein Name L-lactate dehydrogenase A chain
Protein Accession # NP_005557
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express LDHA.
Nucleotide Accession # NM_005566
Replacement Item This antibody may replace item sc-130327 from Santa Cruz Biotechnology.
Conjugation Options

ARP54776_P050-FITC Conjugated

ARP54776_P050-HRP Conjugated

ARP54776_P050-Biotin Conjugated

CB Replacement sc-130327; sc-137243; sc-137244; sc-27230; sc-27231; sc-27232; sc-33781; sc-43893; sc-45898
Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 93%; Sheep: 86%
Image 1
Human Liver
Anti-LDHA antibody IHC of human liver. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. LDHA Antibody concentration 2.5 ug/ml.
Image 2
Human Hela

Host: Rabbit
Target Name: LDHA
Sample Tissue: Human Hela
Antibody Dilution: 1.0ug/ml

Image 3
Human Ovary Tumor

Host: Rabbit
Target Name: LDHA
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |