HINT1 Antibody - N-terminal region (ARP54767_P050)

Data Sheet
 
Product Number ARP54767_P050
Product Page www.avivasysbio.com/hint1-antibody-n-terminal-region-arp54767-p050.html
Name HINT1 Antibody - N-terminal region (ARP54767_P050)
Protein Size (# AA) 126 amino acids
Molecular Weight 14kDa
NCBI Gene Id 3094
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Histidine triad nucleotide binding protein 1
Alias Symbols HINT, NMAN, PKCI-1, PRKCNH1
Peptide Sequence Synthetic peptide located within the following region: CLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAAD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chou,T.F., (2007) Biochemistry 46 (45), 13074-13079
Description of Target HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.
Protein Interactions UBC; CDC16; LEF1; RUVBL2; RUVBL1; CTNNB1; DHX36; RBX1; SP1; CDC34; MITF; SIN3A; HDAC9; KAT5; HINT1; TRIM29;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HINT1 (ARP54767_P050) antibody
Additional Information IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 2.5 ug/ml.
Blocking Peptide For anti-HINT1 (ARP54767_P050) antibody is Catalog # AAP54767 (Previous Catalog # AAPP31562)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HINT1
Uniprot ID P49773
Protein Name Histidine triad nucleotide-binding protein 1
Sample Type Confirmation

HINT1 is strongly supported by BioGPS gene expression data to be expressed in 721_B, Jurkat

Protein Accession # NP_005331
Purification Affinity Purified
Nucleotide Accession # NM_005340
Tested Species Reactivity Human
Gene Symbol HINT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Kidney
Kidney
Image 2
Human 721_B
WB Suggested Anti-HINT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateHINT1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Image 3
Human Jurkat
Host: Rabbit
Target Name: HINT1
Sample Type: Human Jurkat
Antibody Dilution: 1.0ug/mlHINT1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat
Image 4
Human Bronchial Epithelial Tissue
HINT1 antibody - N-terminal region (ARP54767_P050)
Catalog Number: ARP54767_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasm of bronchial epithelial tissue
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com