HINT1 Antibody - N-terminal region (ARP54766_P050)

Data Sheet
 
Product Number ARP54766_P050
Product Page www.avivasysbio.com/hint1-antibody-n-terminal-region-arp54766-p050.html
Name HINT1 Antibody - N-terminal region (ARP54766_P050)
Protein Size (# AA) 126 amino acids
Molecular Weight 14kDa
NCBI Gene Id 3094
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Histidine triad nucleotide binding protein 1
Alias Symbols HINT, NMAN, PKCI-1, PRKCNH1
Peptide Sequence Synthetic peptide located within the following region: ADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chou,T.F., (2007) Biochemistry 46 (45), 13074-13079
Description of Target HINT1 hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester and AMP-NH2.
Protein Interactions UBC; CDC16; LEF1; RUVBL2; RUVBL1; CTNNB1; DHX36; RBX1; SP1; CDC34; MITF; SIN3A; HDAC9; KAT5; HINT1; TRIM29;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HINT1 (ARP54766_P050) antibody
Additional Information IHC Information: Paraffin embedded kidney tissue, tested with an antibody dilution of 2.5 ug/ml.
Blocking Peptide For anti-HINT1 (ARP54766_P050) antibody is Catalog # AAP54766 (Previous Catalog # AAPP31561)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HINT1
Uniprot ID P49773
Protein Name Histidine triad nucleotide-binding protein 1
Sample Type Confirmation

HINT1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_005331
Purification Affinity Purified
Nucleotide Accession # NM_005340
Tested Species Reactivity Human
Gene Symbol HINT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Application WB, IHC
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Bronchial Epithelial Tissue
HINT1 antibody - N-terminal region (ARP54766_P050)
Catalog Number: ARP54766_P050
Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
Observed Staining: Cytoplasm of bronchial epithelial tissue
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 2
Human Kidney
Kidney
Image 3
Human Jurkat
WB Suggested Anti-HINT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysateHINT1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com