ICA1 Antibody - N-terminal region (ARP54742_P050)

Data Sheet
 
Product Number ARP54742_P050
Product Page www.avivasysbio.com/ica1-antibody-n-terminal-region-arp54742-p050.html
Name ICA1 Antibody - N-terminal region (ARP54742_P050)
Protein Size (# AA) 483 amino acids
Molecular Weight 55kDa
NCBI Gene Id 3382
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Islet cell autoantigen 1, 69kDa
Alias Symbols ICA69, ICAp69
Peptide Sequence Synthetic peptide located within the following region: SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
Description of Target ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Protein Interactions RAB2B; ING5; MBD3; CCDC28A; RAB2A; tbc-8; EXOC5; STK16; MKKS; KRT33B; CNTF;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-ICA1 (ARP54742_P050) antibody
Blocking Peptide For anti-ICA1 (ARP54742_P050) antibody is Catalog # AAP54742 (Previous Catalog # AAPP31537)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human ICA1
Uniprot ID Q05084
Protein Name Islet cell autoantigen 1
Sample Type Confirmation

There is BioGPS gene expression data showing that ICA1 is expressed in HepG2

Protein Accession # NP_004959
Purification Affinity Purified
Nucleotide Accession # NM_004968
Tested Species Reactivity Human
Gene Symbol ICA1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB, IHC, IP
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human HepG2
Host: Rabbit
Target Name: ICA1
Sample Type: Human HepG2
Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that ICA1 is expressed in HepG2
Image 2
Human Liver Tissue
ICA1 antibody - N-terminal region (ARP54742_P050)
Catalog Number: ARP54742_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec
Image 3
HEK293 Whole Cell Lysate
ICA1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with ARP54742_P050 with 1:200 dilution. Western blot was performed using ARP54742_P050 at 1/1000 dilution.
Lane 1: Control IP in HEK293 Whole Cell Lysate.
Lane 2: ICA1 IP with ARP54742_P050 in HEK293 Whole Cell Lysate.
Lane 3: Input of HEK293 Whole Cell Lysate.
Image 4
Human HeLa
WB Suggested Anti-ICA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com