Product Number |
ARP54742_P050 |
Product Page |
www.avivasysbio.com/ica1-antibody-n-terminal-region-arp54742-p050.html |
Name |
ICA1 Antibody - N-terminal region (ARP54742_P050) |
Protein Size (# AA) |
483 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
3382 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Islet cell autoantigen 1, 69kDa |
Alias Symbols |
ICA69, ICAp69 |
Peptide Sequence |
Synthetic peptide located within the following region: SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007) |
Description of Target |
ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. |
Protein Interactions |
RAB2B; ING5; MBD3; CCDC28A; RAB2A; tbc-8; EXOC5; STK16; MKKS; KRT33B; CNTF; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ICA1 (ARP54742_P050) antibody |
Blocking Peptide |
For anti-ICA1 (ARP54742_P050) antibody is Catalog # AAP54742 (Previous Catalog # AAPP31537) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ICA1 |
Uniprot ID |
Q05084 |
Protein Name |
Islet cell autoantigen 1 |
Sample Type Confirmation |
There is BioGPS gene expression data showing that ICA1 is expressed in HepG2 |
Protein Accession # |
NP_004959 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_004968 |
Tested Species Reactivity |
Human |
Gene Symbol |
ICA1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB, IHC, IP |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human HepG2
| Host: Rabbit Target Name: ICA1 Sample Type: Human HepG2 Antibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that ICA1 is expressed in HepG2 |
|
Image 2 | Human Liver Tissue
| ICA1 antibody - N-terminal region (ARP54742_P050)
Catalog Number: ARP54742_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
Image 3 | HEK293 Whole Cell Lysate
| ICA1 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with ARP54742_P050 with 1:200 dilution. Western blot was performed using ARP54742_P050 at 1/1000 dilution. Lane 1: Control IP in HEK293 Whole Cell Lysate. Lane 2: ICA1 IP with ARP54742_P050 in HEK293 Whole Cell Lysate. Lane 3: Input of HEK293 Whole Cell Lysate. |
|
Image 4 | Human HeLa
| WB Suggested Anti-ICA1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Hela cell lysate |
|