| Product Number |
ARP54663_P050-Biotin |
| Product Page |
www.avivasysbio.com/inhba-antibody-n-terminal-region-biotin-arp54663-p050-biotin.html |
| Name |
INHBA Antibody - N-terminal region : Biotin (ARP54663_P050-Biotin) |
| Protein Size (# AA) |
426 amino acids |
| Molecular Weight |
44kDa |
| Conjugation |
Biotin |
| NCBI Gene Id |
3624 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Inhibin, beta A |
| Alias Symbols |
EDF, FRP |
| Peptide Sequence |
Synthetic peptide located within the following region: CPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Description of Target |
The inhibin beta A subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta A subunit forms a homodimer, activin A, and also joins with a beta B subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. Finally, it has been shown that the beta A subunit mRNA is identical to the erythroid differentiation factor subunit mRNA and that only one gene for this mRNA exists in the human genome. |
| Protein Interactions |
ACVRL1; ACVR2B; ACVR2A; ACVR1; FST; IGSF1; CHRDL2; FSTL3; IGFBP7; ACVR1B; INHBC; TGFBR3; INHBB; INHA; INHBA; ENG; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-INHBA (ARP54663_P050-Biotin) antibody |
| Blocking Peptide |
For anti-INHBA (ARP54663_P050-Biotin) antibody is Catalog # AAP54663 (Previous Catalog # AAPP44525) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human INHBA |
| Uniprot ID |
P08476 |
| Protein Name |
Inhibin beta A chain |
| Protein Accession # |
NP_002183 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002192 |
| Gene Symbol |
INHBA |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100% |
| Image 1 | |
|
