INHBA Antibody - N-terminal region (ARP54663_P050)

• Product Number: ARP54663_P050
• Name: INHBA Antibody - N-terminal region (ARP54663_P050)
• Protein Size (# AA): 426 amino acids
• Molecular Weight: 44kDa
• NCBI Gene Id: 3624
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Inhibin, beta A
• Alias Symbols: EDF, FRP
• Peptide Sequence: Synthetic peptide located within the following region: CPSCALAALPKDVPNSQPEMVEAVKKHILNMLHLKKRPDVTQPVPKAALL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: The inhibin beta A subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumor-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta A subunit forms a homodimer, activin A, and also joins with a beta B subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. Finally, it has been shown that the beta A subunit mRNA is identical to the erythroid differentiation factor subunit mRNA and that only one gene for this mRNA exists in the human genome.
• Protein Interactions: ACVRL1; ACVR2B; ACVR2A; ACVR1; FST; IGSF1; CHRDL2; FSTL3; IGFBP7; ACVR1B; INHBC; TGFBR3; INHBB; INHA; INHBA; ENG;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-INHBA (ARP54663_P050) antibody is Catalog # AAP54663 (Previous Catalog # AAPP44525)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human INHBA
• Uniprot ID: P08476
• Protein Name: Inhibin beta A chain
• Publications:

  Differential regulation of Janus kinase 3 (JAK3) in bovine preovulatory follicles and identification of JAK3 interacting proteins in granulosa cells. J Ovarian Res. 9, 71 (2016). 27793176

• Protein Accession #: NP_002183
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002192
• Tested Species Reactivity: Human, Rat
• Gene Symbol: INHBA
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
• Image 1: Human Muscle
  
  WB Suggested Anti-INHBA Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Human Muscle
• Image 2: Rat Brain
  
  Host: Rat
  Target Name: INHBA
  Sample Tissue: Rat Brain
  Antibody Dilution: 1ug/ml
• Image 3:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.