Product Number |
ARP54630_P050 |
Product Page |
www.avivasysbio.com/gnai1-antibody-middle-region-arp54630-p050.html |
Name |
GNAI1 Antibody - middle region (ARP54630_P050) |
Protein Size (# AA) |
354 amino acids |
Molecular Weight |
40kDa |
Subunit |
alpha-1 |
NCBI Gene Id |
2770 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 |
Alias Symbols |
Gi |
Peptide Sequence |
Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hurst,J.H., (2008) Cell. Signal. 20 (2), 381-389 |
Description of Target |
Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1); and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs (MIM 139320) and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1; MIM 139311); and transducin-1 (GNAT1; MIM 139330) and transducin-2 (GNAT2; MIM 139340), proteins involved in phototransduction in retinal rods and cones, respectively (Sullivan et al., 1986 [PubMed 3092218]; Bray et al., 1987 [PubMed 3110783]). Suki et al. (1987) [PubMed 2440724] concluded that the human genome contains at least 3 nonallelic genes for alpha-i-type subunits of G protein; see, e.g, GNAI2 (MIM 139360), GNAI3 (MIM 139370), and GNAIH (MIM 139180).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
GPSM3; RGS17; ESR1; ATP4A; RAD52; SVIL; NUCB1; NCF2; MTNR1B; MTNR1A; NCF1; THAP7; RIC8A; RGS14; IQCB1; UBC; RANGAP1; GPR50; GNB1; GNAI3; GNAI2; GNB4; GNB2; PTH1R; PCK1; Haus1; Cep76; Haus4; Recql4; Trim69; Cbx1; PGR; STRN; KLHL3; ADCY5; RASD1; CRHR1; GPSM |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-GNAI1 (ARP54630_P050) antibody |
Blocking Peptide |
For anti-GNAI1 (ARP54630_P050) antibody is Catalog # AAP54630 (Previous Catalog # AAPP31421) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GNAI1 |
Uniprot ID |
P63096 |
Protein Name |
Guanine nucleotide-binding protein G(i) subunit alpha-1 |
Protein Accession # |
NP_002060 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002069 |
Tested Species Reactivity |
Human, Mouse, Rat |
Gene Symbol |
GNAI1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Yeast: 100%; Zebrafish: 85% |
Image 1 | human thryoid
| Sample Type: Nthy-ori cell lysate (50ug) Primary Dilution: 1:1000 Secondary Antibody: anti-rabbit HRP Secondary Dilution: 1:2000 Image Submitted By: Anonymous |
|
Image 2 | Human Fetal Lung
| Host: Rabbit Target Name: GNAI1 Sample Tissue: Human Fetal Lung Antibody Dilution: 1.0ug/ml |
|
Image 3 | Mouse Brain
| Host: Mouse Target Name: GNAI1 Sample Tissue: Mouse Brain Antibody Dilution: 1ug/ml |
|
Image 4 | Rat Brain
| Host: Rat Target Name: GNAI1 Sample Tissue: Rat Brain Antibody Dilution: 1ug/ml |
|
Image 5 | Rat Brain
| Host: Rabbit Target Name: GNAI1 Sample Tissue: Rat Brain Antibody Dilution: 1ug/ml |
|