GNAI1 Antibody - middle region (ARP54630_P050)

Data Sheet
 
Product Number ARP54630_P050
Product Page www.avivasysbio.com/gnai1-antibody-middle-region-arp54630-p050.html
Name GNAI1 Antibody - middle region (ARP54630_P050)
Protein Size (# AA) 354 amino acids
Molecular Weight 40kDa
Subunit alpha-1
NCBI Gene Id 2770
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1
Alias Symbols Gi
Peptide Sequence Synthetic peptide located within the following region: YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hurst,J.H., (2008) Cell. Signal. 20 (2), 381-389
Description of Target Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1); and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs (MIM 139320) and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase; Go, a protein abundant in brain (GNAO1; MIM 139311); and transducin-1 (GNAT1; MIM 139330) and transducin-2 (GNAT2; MIM 139340), proteins involved in phototransduction in retinal rods and cones, respectively (Sullivan et al., 1986 [PubMed 3092218]; Bray et al., 1987 [PubMed 3110783]). Suki et al. (1987) [PubMed 2440724] concluded that the human genome contains at least 3 nonallelic genes for alpha-i-type subunits of G protein; see, e.g, GNAI2 (MIM 139360), GNAI3 (MIM 139370), and GNAIH (MIM 139180).[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions GPSM3; RGS17; ESR1; ATP4A; RAD52; SVIL; NUCB1; NCF2; MTNR1B; MTNR1A; NCF1; THAP7; RIC8A; RGS14; IQCB1; UBC; RANGAP1; GPR50; GNB1; GNAI3; GNAI2; GNB4; GNB2; PTH1R; PCK1; Haus1; Cep76; Haus4; Recql4; Trim69; Cbx1; PGR; STRN; KLHL3; ADCY5; RASD1; CRHR1; GPSM
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GNAI1 (ARP54630_P050) antibody
Blocking Peptide For anti-GNAI1 (ARP54630_P050) antibody is Catalog # AAP54630 (Previous Catalog # AAPP31421)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GNAI1
Uniprot ID P63096
Protein Name Guanine nucleotide-binding protein G(i) subunit alpha-1
Protein Accession # NP_002060
Purification Affinity Purified
Nucleotide Accession # NM_002069
Tested Species Reactivity Human, Mouse, Rat
Gene Symbol GNAI1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Yeast: 100%; Zebrafish: 85%
Image 1
human thryoid
Sample Type: Nthy-ori cell lysate (50ug)
Primary Dilution: 1:1000
Secondary Antibody: anti-rabbit HRP
Secondary Dilution: 1:2000
Image Submitted By: Anonymous
Image 2
Human Fetal Lung
Host: Rabbit
Target Name: GNAI1
Sample Tissue: Human Fetal Lung
Antibody Dilution: 1.0ug/ml
Image 3
Mouse Brain
Host: Mouse
Target Name: GNAI1
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml
Image 4
Rat Brain
Host: Rat
Target Name: GNAI1
Sample Tissue: Rat Brain
Antibody Dilution: 1ug/ml
Image 5
Rat Brain
Host: Rabbit
Target Name: GNAI1
Sample Tissue: Rat Brain
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com