Glrx1 Antibody - middle region : FITC (ARP54625_P050-FITC)

Data Sheet
 
Product Number ARP54625_P050-FITC
Product Page www.avivasysbio.com/glrx1-antibody-middle-region-fitc-arp54625-p050-fitc.html
Name Glrx1 Antibody - middle region : FITC (ARP54625_P050-FITC)
Protein Size (# AA) 107 amino acids
Molecular Weight 11kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 64045
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Glutaredoxin (thioltransferase)
Alias Symbols Grx, Glrx1
Peptide Sequence Synthetic peptide located within the following region: QEILSQLPFKRGLLEFVDITATNNTNAIQDYLQQLTGARTVPRVFIGKDC
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Description of Target Glrx1 catalyzes the deglutathionylation of protein-SS-glutathione mixed disulfides.
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-Glrx (ARP54625_P050-FITC) antibody
Blocking Peptide For anti-Glrx (ARP54625_P050-FITC) antibody is Catalog # AAP54625
Uniprot ID Q9ESH6
Protein Name Glutaredoxin-1
Protein Accession # NP_071614
Purification Affinity Purified
Nucleotide Accession # NM_022278
Gene Symbol Glrx
Predicted Species Reactivity Human, Mouse, Rat, Cow, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 93%; Sheep: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com