| Product Number |
ARP54621_P050 |
| Product Page |
www.avivasysbio.com/gfap-antibody-n-terminal-region-arp54621-p050.html |
| Name |
Gfap Antibody - N-terminal region (ARP54621_P050) |
| Protein Size (# AA) |
418 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
14580 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Glial fibrillary acidic protein |
| Alias Symbols |
AI836096 |
| Peptide Sequence |
Synthetic peptide located within the following region: FSLAGALNAGFKETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAEL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells. |
| Protein Interactions |
Kcnma1; Myo5a; Nphp4; Ywhaz; Pou5f1; Ubc; Ncor1; Stat1; Nr2e1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Gfap (ARP54621_P050) antibody |
| Blocking Peptide |
For anti-Gfap (ARP54621_P050) antibody is Catalog # AAP54621 (Previous Catalog # AAPP31412) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
P03995 |
| Protein Name |
Glial fibrillary acidic protein |
| Protein Accession # |
NP_034407 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_010277 |
| Tested Species Reactivity |
Human, Mouse |
| Gene Symbol |
Gfap |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93% |
| Image 1 | Mouse Thymus
 | Gfap antibody - N-terminal region (ARP54621_P050) validated by WB using Mouse Thymus at 1ug/ml. |
|
| Image 2 | Human optic nerve head
 | Sample Type: human optic nerve head (frozen)
Blue: DAPI
Red: Gfap
Primary Dilution: 1:250
Image Submitted By: Geraint Parfitt
Gavin Herbert Eye Institute See Customer Feedback tab for detailed information.
|
|
| Image 3 | Human Heart Muscle
 | Rabbit Anti-GFAP Antibody
Catalog Number: ARP54621_P050
Formalin Fixed Paraffin Embedded Tissue: Human Heart Muscle Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:600
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
