FTH1 Antibody - middle region (ARP54620_P050)

• Product Number: ARP54620_P050
• Name: FTH1 Antibody - middle region (ARP54620_P050)
• Protein Size (# AA): 183 amino acids
• Molecular Weight: 21 kDa
• NCBI Gene Id: 2495
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Ferritin, heavy polypeptide 1
• Alias Symbols: FHC, FTH, HFE5, PLIF, FTHL6, PIG15
• Peptide Sequence: Synthetic peptide located within the following region: NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKM
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Sammarco,M.C., (2008) J. Biol. Chem. 283 (8), 4578-4587
• Description of Target: FTH1 is the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: SDCBP; FTL; FTH1; WDYHV1; CEP57; AURKB; TP53; AURKA; ASB15; ASB16; SUPT16H; SET; MAPK9; MAX; IGSF8; TICAM2; HCVgp1; PIAS4; CDC16; YWHAE; SOX5; MYL3; LBP; KPNA2; GRB2; DAXX; CSNK2B; CDC25A; ATP6V1B1; CD99; SPP1; TRAF4; SUMO2; UBC; Cep55; Trim28; NR1I3; NR3
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation: SPR Affinity Characterization
  
• Additional Information: IHC Information: Paraffin embedded human kidney tissue, tested with an antibody dilution of 5 ug/ml.
• Blocking Peptide: For anti-FTH1 (ARP54620_P050) antibody is Catalog # AAP54620 (Previous Catalog # AAPP31411)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FTH1
• Uniprot ID: P02794
• Protein Name: Ferritin heavy chain
• Publications:

  Potrykus, J. et al. Fungal Iron Availability during Deep Seated Candidiasis Is Defined by a Complex Interplay Involving Systemic and Local Events. PLoS Pathog. 9, e1003676 (2013). 24146619

• Sample Type Confirmation:

  FTH1 is supported by BioGPS gene expression data to be expressed in HeLa

• Protein Accession #: NP_002023
• Purification: Affinity Purified
• Nucleotide Accession #: NM_002032
• Tested Species Reactivity: Human
• Gene Symbol: FTH1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%
• Image 1: Human Jurkat
  
  WB Suggested Anti-FTH1 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Jurkat cell lysate
• Image 2: Human Kidney
  
  Kidney
• Image 3: Human Hela
  
  Host: Rabbit
  Target Name: FTH1
  Sample Type: Hela
  Antibody Dilution: 1.0ug/mlFTH1 is supported by BioGPS gene expression data to be expressed in HeLa
• Image 4: Jurkat
  
  Host: Rabbit
  Target Name: FTH1
  Sample Type: Jurkat
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 1ug/ml
  Peptide Concentration: 5ug/ml
  Lysate Quantity: 25ug/lane/lane
  Gel Concentration: 0.12
• Image 5:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.