GCLC Antibody - N-terminal region (ARP54576_P050)

• Product Number: ARP54576_P050
• Name: GCLC Antibody - N-terminal region (ARP54576_P050)
• Protein Size (# AA): 637 amino acids
• Molecular Weight: 73 kDa
• NCBI Gene Id: 2729
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Glutamate-cysteine ligase, catalytic subunit
• Alias Symbols: GCL, GCS, GLCL, GLCLC
• Peptide Sequence: Synthetic peptide located within the following region: VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Jonsson,L.S., (2008) Int Arch Occup Environ Health 81 (7), 913-919
• Description of Target: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. The gene encoding the catalytic subunit encodes a protein of 367 amino acids with a calculated molecular weight of 72.773 kDa and maps to chromosome 6. The regulatory subunit is derived from a different gene located on chromosome 1p22-p21. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; PPID; GCLM; CCL22; PAXIP1; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR	Y
  YCHAROS

• Blocking Peptide: For anti-GCLC (ARP54576_P050) antibody is Catalog # AAP54576 (Previous Catalog # AAPP31360)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GCLC
• Uniprot ID: P48506
• Protein Name: Glutamate-cysteine ligase EMBL BAE97618.1
• Publications:

  Tomasi, M. L. et al. Molecular mechanisms of lipopolysaccharide-mediated inhibition of glutathione synthesis in mice. Free Radic. Biol. Med. 68, 148-58 (2014). 24296246

• Protein Accession #: NP_001489
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001498
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: GCLC
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Image 1: Human Liver
  
  WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Liver
• Image 2: Human Liver
  
  WB Suggested Anti-GCLC Antibody Titration: 0.2-1 ug/ml. A: - blocking peptide. B: + blocking peptide.
• Image 3: Mouse heart
  
  Lanes:
  1: 40ug mouse heart lysate, 2: 40ug mouse heart lysate, 3: 40ug mouse heart lysate, 4: 40ug mouse heart lysate, 5: 40ug mouse heart lysate
  Primary Antibody Dilution:
  1:1000
  Secondary Antibody:
  Anti-rabbit HRP
  Secondary Antibody Dilution:
  1:10000
  Gene Name:
  GCLC
  Submitted by:
  Anonymous
  
• Image 4: Human Bronchial Epithelial Tissue
  
  GCLC antibody - N-terminal region (ARP54576_P050)
  Catalog Number: ARP54576_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
  Observed Staining: Cytoplasm and membrane of bronchial epithelial tissue
  Primary Antibody Concentration: 1:600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 5:
  
  Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.