ARG2 Antibody - C-terminal region (ARP54567_P050)

• Product Number: ARP54567_P050
• Name: ARG2 Antibody - C-terminal region (ARP54567_P050)
• Protein Size (# AA): 354 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 384
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Arginase, type II
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: SALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPT
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mumenthaler,S.M., (2008) Int. J. Oncol. 32 (2), 357-365
• Description of Target: Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. ARG2 (type II isoform) is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type II isoform encoded by this gene, is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism. Transcript variants of the type II gene resulting from the use of alternative polyadenylation sites have been described. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; ARG1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ARG2 (ARP54567_P050) antibody is Catalog # AAP54567 (Previous Catalog # AAPP31351)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARG2
• Uniprot ID: P78540
• Protein Name: Arginase-2, mitochondrial
• Publications:

  Lukasova, M., Malaval, C., Gille, A., Kero, J. & Offermanns, S. Nicotinic acid inhibits progression of atherosclerosis in mice through its receptor GPR109A expressed by immune cells. J. Clin. Invest. 121, 1163-73 (2011). 21317532

• Sample Type Confirmation:

  ARG2 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_001163
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001172
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: ARG2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB, IP
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 87%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Image 1: MCF7, Human liver
  
  Host: Rabbit
  Target: ARG2
  Positive control (+): MCF7 (N10)
  Negative control (-): Human liver (LI)
  Antibody concentration: 1ug/ml
• Image 2: HEK293 Whole Cell Lysate
  
  ARG2 was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with ARP54567_P050 with 1:200 dilution. Western blot was performed using ARP54567_P050 at 1/1000 dilution.
  Lane 1: Control IP in HEK293 Whole Cell Lysate.
  Lane 2: ARG2 IP with ARP54567_P050 in HEK293 Whole Cell Lysate.
  Lane 3: Input of HEK293 Whole Cell Lysate.
• Image 3: Human Jurkat
  
  WB Suggested Anti-ARG2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysateARG2 is supported by BioGPS gene expression data to be expressed in Jurkat
• Image 4: Jurkat
  
  Host: Rabbit
  Target Name: ARG2
  Sample Type: Jurkat
  Lane A: Primary Antibody
  Lane B: Primary Antibody + Blocking Peptide
  Primary Antibody Concentration: 1ug/ml
  Peptide Concentration: 5ug/ml
  Lysate Quantity: 25ug/lane/lane
  Gel Concentration: 0.12
• Image 5: Mouse Pancreas
  
  Host: Mouse
  Target Name: ARG2
  Sample Tissue: Mouse Pancreas
  Antibody Dilution: 1ug/ml