| Product Number |
ARP54528_P050 |
| Product Page |
www.avivasysbio.com/arsa-antibody-n-terminal-region-arp54528-p050.html |
| Name |
ARSA Antibody - N-terminal region (ARP54528_P050) |
| Protein Size (# AA) |
507 amino acids |
| Molecular Weight |
56kDa |
| NCBI Gene Id |
410 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Arylsulfatase A |
| Alias Symbols |
ASA, MLD |
| Peptide Sequence |
Synthetic peptide located within the following region: DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Saito,S., (2008) Mol. Genet. Metab. 93 (4), 419-425 |
| Description of Target |
ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene. |
| Protein Interactions |
TRIP13; PPIC; CETN2; CLEC4G; ARSA; GAL3ST1; BMPR2; CTSL; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ARSA (ARP54528_P050) antibody |
| Blocking Peptide |
For anti-ARSA (ARP54528_P050) antibody is Catalog # AAP54528 (Previous Catalog # AAPP31312) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ARSA |
| Uniprot ID |
P15289 |
| Protein Name |
Arylsulfatase A |
| Protein Accession # |
NP_000478 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000487 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ARSA |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human COLO205
 | WB Suggested Anti-ARSA Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: COLO205 cell lysate |
|
|
