| Product Number |
ARP54517_P050-FITC |
| Product Page |
www.avivasysbio.com/pcdh17-antibody-c-terminal-region-fitc-arp54517-p050-fitc.html |
| Name |
PCDH17 Antibody - C-terminal region : FITC (ARP54517_P050-FITC) |
| Protein Size (# AA) |
1159 amino acids |
| Molecular Weight |
124kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
27253 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protocadherin 17 |
| Alias Symbols |
PCH68, PCDH68 |
| Peptide Sequence |
Synthetic peptide located within the following region: SEMGAVLEQLDHPNRDLGRESVDAEEVVREIDKLLQDCRGNDPVAVRK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Szafranski,K., Genome Biol. 8 (8), R154 (2007) |
| Description of Target |
PCDH17 contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins.It may play a role in the establishment and function of specific cell-cell connections in the brain.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein contains six extracellular cadherin domains, a transmembrane domain, and a cytoplasmic tail differing from those of the classical cadherins. The encoded protein may play a role in the establishment and function of specific cell-cell connections in the brain. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-866 AL445288.9 90051-90916 867-4389 BC028165.1 1-3523 4390-8009 AL445216.6 89335-92954 |
| Protein Interactions |
UBQLN4; ZP3; NR1H2; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-PCDH17 (ARP54517_P050-FITC) antibody |
| Blocking Peptide |
For anti-PCDH17 (ARP54517_P050-FITC) antibody is Catalog # AAP54517 (Previous Catalog # AAPP31301) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PCDH17 |
| Uniprot ID |
O14917 |
| Protein Name |
Protocadherin-17 |
| Protein Accession # |
NP_001035519 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001040429 |
| Gene Symbol |
PCDH17 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | |
|
