PGBD2 Antibody - middle region (ARP54446_P050)

• Product Number: ARP54446_P050
• Name: PGBD2 Antibody - middle region (ARP54446_P050)
• Protein Size (# AA): 341 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 267002
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: PiggyBac transposable element derived 2
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: RICCQDAQVDLLAFRRYIACVYLESNADTTSQGRRSRRLETESRFDMIGH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Xiang,Z., (2001) Genomics 72 (1), 105-107
• Description of Target: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known. Two transcript variants encoding different isoforms have been found for this gene.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PGBD2 (ARP54446_P050) antibody is Catalog # AAP54446 (Previous Catalog # AAPP31226)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PGBD2
• Uniprot ID: B3KVR8
• Protein Name: PiggyBac transposable element-derived protein 2
• Protein Accession #: NP_001017434
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001017434
• Tested Species Reactivity: Human
• Gene Symbol: PGBD2
• Predicted Species Reactivity: Human, Cow, Dog, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 79%; Horse: 93%; Human: 100%; Rabbit: 93%
• Image 1: Human Liver
  
  WB Suggested Anti-PGBD2 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Liver