C17orf97 Antibody - N-terminal region (ARP54431_P050)

• Name: C17orf97 Antibody - N-terminal region (ARP54431_P050)
• Protein Size (# AA): 433 amino acids
• Molecular Weight: 47kDa
• NCBI Gene Id: 400566
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Chromosome 17 open reading frame 97
• Alias Symbols: CK20, LIAT1
• Peptide Sequence: Synthetic peptide located within the following region: VSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903
• Description of Target: The exact function of LOC400566 remains unknown.
• Protein Interactions: SUMO1; NEDD8; JMJD6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-C17orf97 (ARP54431_P050) antibody is Catalog # AAP54431 (Previous Catalog # AAPP31211)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC400566
• Uniprot ID: Q6ZQX7-3
• Protein Name: Uncharacterized protein C17orf97
• Protein Accession #: NP_001013694
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001013672
• Tested Species Reactivity: Human
• Gene Symbol: C17orf97
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 86%; Rabbit: 93%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-C17orf97 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate