| Product Number |
ARP54427_P050 |
| Product Page |
www.avivasysbio.com/ccdc184-antibody-middle-region-arp54427-p050.html |
| Name |
CCDC184 Antibody - middle region (ARP54427_P050) |
| Protein Size (# AA) |
194 amino acids |
| Molecular Weight |
20kDa |
| NCBI Gene Id |
387856 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
coiled-coil domain containing 184 |
| Alias Symbols |
C12orf68 |
| Peptide Sequence |
Synthetic peptide located within the following region: LQALFEDVRAMRGALDEQASHIQVLSDDVCANQRAIVSMCQIMTTAPRQG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006) |
| Protein Interactions |
PBLD; WDYHV1; PPP1R13B; STX11; GPANK1; TRAF5; RPL9; PIN1; CUL5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CCDC184 (ARP54427_P050) antibody |
| Blocking Peptide |
For anti-CCDC184 (ARP54427_P050) antibody is Catalog # AAP54427 (Previous Catalog # AAPP31207) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LOC387856 |
| Uniprot ID |
Q52MB2 |
| Protein Name |
coiled-coil domain-containing protein 184 |
| Protein Accession # |
NP_001013657 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001013635 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CCDC184 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human Muscle
 | WB Suggested Anti-C12orf68 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle |
|
|
