C6orf154 Antibody - middle region (ARP54422_P050)

• Name: C6orf154 Antibody - middle region (ARP54422_P050)
• Protein Size (# AA): 316 amino acids
• Molecular Weight: 33kDa
• NCBI Gene Id: 221424
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Leucine rich repeat containing 73
• Alias Symbols: C6orf154
• Peptide Sequence: Synthetic peptide located within the following region: NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mungall,A.J., (2003) Nature 425 (6960), 805-811
• Description of Target: The specific function of this protein remains unknown.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LRRC73 (ARP54422_P050) antibody is Catalog # AAP54422 (Previous Catalog # AAPP37303)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf154
• Uniprot ID: Q5JTD7
• Protein Name: Leucine-rich repeat-containing protein 73
• Protein Accession #: NP_001012992
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001012974
• Tested Species Reactivity: Human
• Gene Symbol: LRRC73
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human COLO205
  
  WB Suggested Anti-C6orf154 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: COLO205 cell lysate