MAGEA4 Antibody - C-terminal region : Biotin (ARP54410_P050-Biotin)

• Product Number: ARP54410_P050-Biotin
• Name: MAGEA4 Antibody - C-terminal region : Biotin (ARP54410_P050-Biotin)
• Protein Size (# AA): 317 amino acids
• Molecular Weight: 35kDa
• Conjugation: Biotin
• NCBI Gene Id: 4103
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Melanoma antigen family A, 4
• Alias Symbols: CT1.4, MAGE4, MAGE4A, MAGE4B, MAGE-41, MAGE-X2
• Peptide Sequence: Synthetic peptide located within the following region: ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Reference: Ries,J., (2008) J. Oral Pathol. Med. 37 (2), 88-93
• Description of Target: MAGEA4 is a member of the MAGEA family. The members of this family are proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. At least four variants encoding the same protein have been found for this gene.
• Protein Interactions: AMOTL2; WBP2; UQCRB; TK1; GTF3C1; TEKT4; TRIM69; TIGD5; BEX2; UBXN6; AMOT; ARNT2; UBC; APP; HLA-A; PIAS2; PSMD10; POT1;
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Blocking Peptide: For anti-MAGEA4 (ARP54410_P050-Biotin) antibody is Catalog # AAP54410 (Previous Catalog # AAPP31185)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAGEA4
• Uniprot ID: P43358
• Protein Name: Melanoma-associated antigen 4
• Protein Accession #: NP_001011548
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001011548
• Gene Symbol: MAGEA4
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 93%; Rabbit: 79%; Rat: 86%
• Image 1: