Product Number |
ARP54397_P050 |
Product Page |
www.avivasysbio.com/0910001l09rik-antibody-n-terminal-region-arp54397-p050.html |
Name |
Lamtor4 Antibody - N-terminal region (ARP54397_P050) |
Protein Size (# AA) |
99 amino acids |
Molecular Weight |
11kDa |
NCBI Gene Id |
66096 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
RIKEN cDNA 0910001L09 gene |
Alias Symbols |
AV006840, 0910001L09Rik |
Peptide Sequence |
Synthetic peptide located within the following region: MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of this protein remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Lamtor4 (ARP54397_P050) antibody |
Blocking Peptide |
For anti-Lamtor4 (ARP54397_P050) antibody is Catalog # AAP54397 |
Uniprot ID |
Q8CF66 |
Protein Name |
Ragulator complex protein LAMTOR4 |
Protein Accession # |
NP_001074577 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001081108 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
Lamtor4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Mouse Heart
| WB Suggested Anti-0910001L09Rik Antibody Titration: 1.0 ug/ml Positive Control: Mouse Heart |
|
|