FAM13C1 Antibody - N-terminal region : Biotin (ARP54376_P050-Biotin)

Data Sheet
 
Product Number ARP54376_P050-Biotin
Product Page www.avivasysbio.com/fam13c1-antibody-n-terminal-region-biotin-arp54376-p050-biotin.html
Name FAM13C1 Antibody - N-terminal region : Biotin (ARP54376_P050-Biotin)
Protein Size (# AA) 487 amino acids
Molecular Weight 55kDa
Conjugation Biotin
NCBI Gene Id 220965
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Family with sequence similarity 13, member C
Alias Symbols FAM13C1
Peptide Sequence Synthetic peptide located within the following region: TEHVVSSQSECQVRAGTPAHESPQNNAFKCQETVRLQPRIDQRTAISPKD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Description of Target FAM13C1 belongs to the FAM13 family. The exact function of FAM13C1 remains unknown.
Protein Interactions CCDC172; FAM13C; CEP70; HMBOX1; MED4; SDCBP2; TFIP11; MTUS2; MEOX2; KIF2A; PHC2; DVL3; CCDC85B;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-FAM13C (ARP54376_P050-Biotin) antibody
Blocking Peptide For anti-FAM13C (ARP54376_P050-Biotin) antibody is Catalog # AAP54376 (Previous Catalog # AAPP31151)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FAM13C1
Uniprot ID Q8NE31
Protein Name Protein FAM13C
Protein Accession # NP_001001971
Purification Affinity Purified
Nucleotide Accession # NM_001001971
Gene Symbol FAM13C
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 92%; Guinea Pig: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com