| Product Number |
ARP54358_P050 |
| Product Page |
https://www.avivasysbio.com/guk1-antibody-middle-region-arp54358-p050.html |
| Name |
GUK1 Antibody - middle region (ARP54358_P050) |
| Protein Size (# AA) |
197 amino acids |
| Molecular Weight |
22kDa |
| NCBI Gene Id |
2987 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Guanylate kinase 1 |
| Alias Symbols |
GMK |
| Peptide Sequence |
Synthetic peptide located within the following region: IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Brady,W.A., (1996) J. Biol. Chem. 271 (28), 16734-16740 |
| Description of Target |
GUK1 is essential for recycling GMP and indirectly, cGMP. |
| Protein Interactions |
UBC; HNRNPD; IQCB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GUK1 (ARP54358_P050) antibody |
| Blocking Peptide |
For anti-GUK1 (ARP54358_P050) antibody is Catalog # AAP54358 (Previous Catalog # AAPP31133) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human GUK1 |
| Uniprot ID |
Q16774 |
| Protein Name |
Guanylate kinase |
| Protein Accession # |
NP_000849 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000858 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GUK1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 86% |
| Image 1 | Human kidney
 | WB Suggested Anti-GUK1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human kidney |
|
|
