| Product Number |
ARP54334_P050-FITC |
| Product Page |
www.avivasysbio.com/igfbp2-antibody-middle-region-fitc-arp54334-p050-fitc.html |
| Name |
IGFBP2 Antibody - middle region : FITC (ARP54334_P050-FITC) |
| Protein Size (# AA) |
328 amino acids |
| Molecular Weight |
35kDa |
| Conjugation |
FITC: Fluorescein Isothiocyanate |
| NCBI Gene Id |
3485 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Insulin-like growth factor binding protein 2, 36kDa |
| Alias Symbols |
IBP2, IGF-BP53 |
| Peptide Sequence |
Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Reference |
Hertel,J.K., (2008) Diabetologia 51 (6), 971-977 |
| Description of Target |
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. |
| Protein Interactions |
INO80B; GSDMB; TF; KLK2; IGF2; IGF1; CTNNB1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-IGFBP2 (ARP54334_P050-FITC) antibody |
| Blocking Peptide |
For anti-IGFBP2 (ARP54334_P050-FITC) antibody is Catalog # AAP54334 (Previous Catalog # AAPP31082) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human IGFBP2 |
| Uniprot ID |
P18065 |
| Protein Name |
Insulin-like growth factor-binding protein 2 |
| Protein Accession # |
NP_000588 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000597 |
| Gene Symbol |
IGFBP2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 100% |
| Image 1 | |
|
