IGFBP2 Antibody - middle region : FITC (ARP54334_P050-FITC)

Data Sheet
 
Product Number ARP54334_P050-FITC
Product Page www.avivasysbio.com/igfbp2-antibody-middle-region-fitc-arp54334-p050-fitc.html
Name IGFBP2 Antibody - middle region : FITC (ARP54334_P050-FITC)
Protein Size (# AA) 328 amino acids
Molecular Weight 35kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 3485
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Insulin-like growth factor binding protein 2, 36kDa
Alias Symbols IBP2, IGF-BP53
Peptide Sequence Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Hertel,J.K., (2008) Diabetologia 51 (6), 971-977
Description of Target IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
Protein Interactions INO80B; GSDMB; TF; KLK2; IGF2; IGF1; CTNNB1;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-IGFBP2 (ARP54334_P050-FITC) antibody
Blocking Peptide For anti-IGFBP2 (ARP54334_P050-FITC) antibody is Catalog # AAP54334 (Previous Catalog # AAPP31082)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IGFBP2
Uniprot ID P18065
Protein Name Insulin-like growth factor-binding protein 2
Protein Accession # NP_000588
Purification Affinity Purified
Nucleotide Accession # NM_000597
Gene Symbol IGFBP2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Goat: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Sheep: 100%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com