| Product Number |
ARP54309_P050 |
| Product Page |
www.avivasysbio.com/guca1a-antibody-n-terminal-region-arp54309-p050.html |
| Name |
GUCA1A Antibody - N-terminal region (ARP54309_P050) |
| Protein Size (# AA) |
201 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
2978 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Guanylate cyclase activator 1A (retina) |
| Alias Symbols |
COD3, GCAP, GUCA, GCAP1, GUCA1, CORD14, C6orf131 |
| Peptide Sequence |
Synthetic peptide located within the following region: LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Michaelides,M., (2005) Ophthalmology 112 (8), 1442-1447 |
| Description of Target |
GUCA1A(GCAP1) plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia. |
| Protein Interactions |
GUCY2D; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GUCA1A (ARP54309_P050) antibody |
| Blocking Peptide |
For anti-GUCA1A (ARP54309_P050) antibody is Catalog # AAP54309 (Previous Catalog # AAPP31058) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human GUCA1A |
| Uniprot ID |
P43080 |
| Protein Name |
Guanylyl cyclase-activating protein 1 |
| Protein Accession # |
NP_000400 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_000409 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GUCA1A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human kidney
 | WB Suggested Anti-GUCA1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human kidney |
|
