Product Number |
ARP54283_P050 |
Product Page |
www.avivasysbio.com/apoe-antibody-n-terminal-region-arp54283-p050.html |
Name |
APOE Antibody - N-terminal region (ARP54283_P050) |
Protein Size (# AA) |
317 amino acids |
Molecular Weight |
36 kDa |
NCBI Gene Id |
348 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Apolipoprotein E |
Description |
|
Alias Symbols |
AD2, LPG, APO-E, ApoE4, LDLCQ5 |
Peptide Sequence |
Synthetic peptide located within the following region: KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ho,R.C., (2008) Am J Geriatr Psychiatry 16 (6), 519-522 |
Description of Target |
Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
LCAT; ARFGAP1; ALB; C19orf52; LOXL4; PRAM1; MID1IP1; ANKH; FBXL12; FXYD7; ECSIT; PDCD4; IFIT5; MAST1; EPN2; PLEKHA6; CDC37; IQSEC1; LONP1; TYRO3; PRDX2; ST13; RPL4; RHEB; PSEN1; HTRA1; PCMT1; ZNF558; NOS3; IFIT3; GCDH; FOXG1; FARSA; ELAVL1; CYP2C18; CYP2C |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
Relative Expression (Western Blot) |
|
SPR Affinity Characterization |
|
|
Datasheets/Manuals |
Printable datasheet for anti-APOE (ARP54283_P050) antibody |
Additional Information |
IHC Information: Human Adrenal: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE) |
Blocking Peptide |
For anti-APOE (ARP54283_P050) antibody is Catalog # AAP54283 (Previous Catalog # AAPP31032) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human APOE |
Uniprot ID |
P02649 |
Protein Name |
Apolipoprotein E |
Publications |
Evaluation of Apolipoprotein E Fragmentation as a Biomarker for Alzheimer's Disease. J Neurol Neurol Disord. 3, (2017). 29520379
Nuclear uptake of an amino-terminal fragment of apolipoprotein E4 promotes cell death and localizes within microglia of the Alzheimer's disease brain. Int J Physiol Pathophysiol Pharmacol. 9, 40-57 (2017). 28533891
Proteolytic Cleavage of Apolipoprotein E in the Down Syndrome Brain. Aging Dis. 7, 267-77 (2016). 27330841
Rohn, T. T., Catlin, L. W., Coonse, K. G. & Habig, J. W. Identification of an amino-terminal fragment of apolipoprotein E4 that localizes to neurofibrillary tangles of the Alzheimerâs disease brain. Brain Res. 1475, 106-15 (2012). 22902767
Rohn, T. T., Day, R. J., Sheffield, C. B., Rajic, A. J. & Poon, W. W. Apolipoprotein E pathology in vascular dementia. Int. J. Clin. Exp. Pathol. 7, 938-47 (2014). 24696712 |
Protein Accession # |
NP_000032 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_000041 |
Tested Species Reactivity |
Human, Mouse, Rat |
Gene Symbol |
APOE |
Predicted Species Reactivity |
Human |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Fetal liver
| APOE antibody - N-terminal region (ARP54283_P050) validated by WB using Fetal liver cell lysate at 1ug/ml. |
|
Image 2 | Human Adrenal
| Anti-APOE / Apolipoprotein E antibody IHC staining of human adrenal. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
Image 3 | Human kidney.
| Anti-APOE / Apolipoprotein E antibody IHC staining of human kidney. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml. |
|
Image 4 | Rat Brain
| APOE antibody - N-terminal region (ARP54283_P050) validated by WB using Rat brain lysate at 1: 500 |
|
Image 5 | Human Brain
| Human Brain and cell Homogenates
Dilution : 1:1000/ 1:2000 |
|
Image 6 | Human Liver Tumor
| Host: Rabbit Target Name: APOE Sample Tissue: Human Liver Tumor Antibody Dilution: 3ug/ml |
|
Image 7 | Human Liver Tissue
| APOE antibody - N-terminal region (ARP54283_P050)
Catalog Number: ARP54283_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm and membrane of hepatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
Image 8 | Western Blot
| 25 ug of the indicated Human whole cell and tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. |
|
Image 9 |
| Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/mL in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.
|
|