| Product Number |
ARP53848_P050 |
| Product Page |
https://www.avivasysbio.com/paox-antibody-middle-region-arp53848-p050.html |
| Name |
PAOX Antibody - middle region (ARP53848_P050) |
| Protein Size (# AA) |
486 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
196743 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Polyamine oxidase (exo-N4-amino) |
| Alias Symbols |
PAO |
| Peptide Sequence |
Synthetic peptide located within the following region: RGSAVGMEGGRPPPQSVGPAGAAAQAQALAGPSLLCSTRVGGRLGPSFLL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Jarvinen,A., (2006) J. Biol. Chem. 281 (8), 4589-4595 |
| Description of Target |
PAOX belongs to the flavin monoamine oxidase family. PAOX is a flavoenzyme which catalyzes the oxidation of N(1)-acetylspermine to spermidine and is thus involved in the polyamine back-conversion. It can also oxidize N(1)-acetylspermidine to putrescine. PAOX does not oxidize spermidine. It plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. |
| Protein Interactions |
PEX5; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PAOX (ARP53848_P050) antibody |
| Blocking Peptide |
For anti-PAOX (ARP53848_P050) antibody is Catalog # AAP53848 (Previous Catalog # AAPP32980) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human PAOX |
| Uniprot ID |
Q6QHF9-4 |
| Protein Name |
Peroxisomal N(1)-acetyl-spermine/spermidine oxidase |
| Protein Accession # |
NP_997011 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_207128 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PAOX |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human Fetal Brain
 | Host: Rabbit
Target Name: PAOX
Sample Type: Human Fetal Brain
Antibody Dilution: 1.0ug/ml |
| | Image 2 | Human Jurkat
 | WB Suggested Anti-PAOX Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
|
