Product Number |
ARP53826_P050-FITC |
Product Page |
www.avivasysbio.com/lpin1-antibody-n-terminal-region-fitc-arp53826-p050-fitc.html |
Name |
LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC) |
Protein Size (# AA) |
890 amino acids |
Molecular Weight |
98kDa |
Conjugation |
FITC: Fluorescein Isothiocyanate |
NCBI Gene Id |
23175 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Lipin 1 |
Alias Symbols |
PAP1 |
Peptide Sequence |
Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer. |
Reference |
Ong,K.L., (2008) Am. J. Hypertens. 21 (5), 539-545 |
Description of Target |
This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
FBXW11; PAH1; CDK6; UBC; PPARA; NFATC4; |
Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Datasheets/Manuals |
Printable datasheet for anti-LPIN1 (ARP53826_P050-FITC) antibody |
Blocking Peptide |
For anti-LPIN1 (ARP53826_P050-FITC) antibody is Catalog # AAP53826 (Previous Catalog # AAPP30863) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1 |
Uniprot ID |
Q14693 |
Protein Name |
Phosphatidate phosphatase LPIN1 |
Sample Type Confirmation |
LPIN1 is strongly supported by BioGPS gene expression data to be expressed in 721_B |
Protein Accession # |
NP_663731 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_145693 |
Gene Symbol |
LPIN1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast, Zebrafish |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 91%; Zebrafish: 91% |
Image 1 | |
|