LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)

Data Sheet
 
Product Number ARP53826_P050-FITC
Product Page www.avivasysbio.com/lpin1-antibody-n-terminal-region-fitc-arp53826-p050-fitc.html
Name LPIN1 Antibody - N-terminal region : FITC (ARP53826_P050-FITC)
Protein Size (# AA) 890 amino acids
Molecular Weight 98kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 23175
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lipin 1
Alias Symbols PAP1
Peptide Sequence Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Ong,K.L., (2008) Am. J. Hypertens. 21 (5), 539-545
Description of Target This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions FBXW11; PAH1; CDK6; UBC; PPARA; NFATC4;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-LPIN1 (ARP53826_P050-FITC) antibody
Blocking Peptide For anti-LPIN1 (ARP53826_P050-FITC) antibody is Catalog # AAP53826 (Previous Catalog # AAPP30863)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1
Uniprot ID Q14693
Protein Name Phosphatidate phosphatase LPIN1
Sample Type Confirmation

LPIN1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_663731
Purification Affinity Purified
Nucleotide Accession # NM_145693
Gene Symbol LPIN1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 91%; Zebrafish: 91%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com