LPIN1 Antibody - N-terminal region (ARP53826_P050)

• Product Number: ARP53826_P050
• Name: LPIN1 Antibody - N-terminal region (ARP53826_P050)
• Protein Size (# AA): 890 amino acids
• Molecular Weight: 98kDa
• NCBI Gene Id: 23175
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Lipin 1
• Alias Symbols: PAP1
• Peptide Sequence: Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ong,K.L., (2008) Am. J. Hypertens. 21 (5), 539-545
• Description of Target: This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: FBXW11; PAH1; CDK6; UBC; PPARA; NFATC4;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LPIN1 (ARP53826_P050) antibody is Catalog # AAP53826 (Previous Catalog # AAPP30863)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1
• Uniprot ID: Q14693
• Protein Name: Phosphatidate phosphatase LPIN1
• Sample Type Confirmation:

  LPIN1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

• Protein Accession #: NP_663731
• Purification: Affinity Purified
• Nucleotide Accession #: NM_145693
• Tested Species Reactivity: Human
• Gene Symbol: LPIN1
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast, Zebrafish
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 91%; Zebrafish: 91%
• Image 1: Human 721_B
  
  WB Suggested Anti-LPIN1 Antibody Titration: 0.2-1 ug/ml
  Positive Control: 721_B cell lysateLPIN1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
• Image 2: Human Pineal Tissue
  
  Rabbit Anti-LPIN1 Antibody
  Catalog Number: ARP53826_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
  Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes
  Primary Antibody Concentration: 1:100
  Other Working Concentrations: 1/600
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec