LPIN1 Antibody - N-terminal region (ARP53826_P050)

Data Sheet
 
Product Number ARP53826_P050
Product Page https://www.avivasysbio.com/lpin1-antibody-n-terminal-region-arp53826-p050.html
Name LPIN1 Antibody - N-terminal region (ARP53826_P050)
Protein Size (# AA) 890 amino acids
Molecular Weight 98kDa
NCBI Gene Id 23175
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lipin 1
Alias Symbols PAP1
Peptide Sequence Synthetic peptide located within the following region: SLAVIYPQSASYPNSDREWSPTPSPSGSRPSTPKSDSELVSKSTERTGQK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ong,K.L., (2008) Am. J. Hypertens. 21 (5), 539-545
Description of Target This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that LPIN1 functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. This gene represents a candidate gene for human lipodystrophy, characterized by loss of body fat, fatty liver, hypertriglyceridemia, and insulin resistance. Mouse studies suggest that this gene functions during normal adipose tissue development and may also play a role in human triglyceride metabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions FBXW11; PAH1; CDK6; UBC; PPARA; NFATC4;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LPIN1 (ARP53826_P050) antibody
Blocking Peptide For anti-LPIN1 (ARP53826_P050) antibody is Catalog # AAP53826 (Previous Catalog # AAPP30863)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LPIN1
Uniprot ID Q14693
Protein Name Phosphatidate phosphatase LPIN1
Sample Type Confirmation

LPIN1 is strongly supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_663731
Purification Affinity Purified
Nucleotide Accession # NM_145693
Tested Species Reactivity Human
Gene Symbol LPIN1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep, Yeast, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Yeast: 91%; Zebrafish: 91%
Image 1
Human 721_B
WB Suggested Anti-LPIN1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateLPIN1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells
Image 2
Human Pineal Tissue
Rabbit Anti-LPIN1 Antibody
Catalog Number: ARP53826_P050
Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue
Observed Staining: Cytoplasmic and membrane in cell bodies and processes of pinealocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec