CLPB Antibody - N-terminal region : FITC (ARP53790_P050-FITC)

Data Sheet
 
Product Number ARP53790_P050-FITC
Product Page www.avivasysbio.com/clpb-antibody-n-terminal-region-fitc-arp53790-p050-fitc.html
Name CLPB Antibody - N-terminal region : FITC (ARP53790_P050-FITC)
Protein Size (# AA) 707 amino acids
Molecular Weight 78kDa
Conjugation FITC: Fluorescein Isothiocyanate
NCBI Gene Id 81570
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ClpB caseinolytic peptidase B homolog (E. coli)
Alias Symbols SKD3, HSP78, MGCA7, ANKCLB, MEGCANN
Peptide Sequence Synthetic peptide located within the following region: QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer.
Reference Colland,F., (2004) Genome Res. 14 (7), 1324-1332
Description of Target CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.
Protein Interactions CEP70; IRS4; UBC; HDAC11; MDFI; SMAD9; CUL3; TERF2; UCHL3; OSBPL10; USP30; COPS6; TTF2;
Reconstitution and Storage All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Datasheets/Manuals Printable datasheet for anti-CLPB (ARP53790_P050-FITC) antibody
Blocking Peptide For anti-CLPB (ARP53790_P050-FITC) antibody is Catalog # AAP53790 (Previous Catalog # AAPP30852)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CLPB
Uniprot ID Q9H078
Protein Name Caseinolytic peptidase B protein homolog
Protein Accession # NP_110440
Purification Affinity Purified
Nucleotide Accession # NM_030813
Gene Symbol CLPB
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 77%; Rabbit: 85%; Rat: 92%
Image 1

 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com