CLPB Antibody - N-terminal region (ARP53790_P050)

Data Sheet
 
Product Number ARP53790_P050
Product Page www.avivasysbio.com/clpb-antibody-n-terminal-region-arp53790-p050.html
Name CLPB Antibody - N-terminal region (ARP53790_P050)
Protein Size (# AA) 707 amino acids
Molecular Weight 78kDa
NCBI Gene Id 81570
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name ClpB caseinolytic peptidase B homolog (E. coli)
Description
Alias Symbols SKD3, HSP78, MGCA7, ANKCLB, MEGCANN
Peptide Sequence Synthetic peptide located within the following region: QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Colland,F., (2004) Genome Res. 14 (7), 1324-1332
Description of Target CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.
Protein Interactions CEP70; IRS4; UBC; HDAC11; MDFI; SMAD9; CUL3; TERF2; UCHL3; OSBPL10; USP30; COPS6; TTF2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CLPB (ARP53790_P050) antibody
Blocking Peptide For anti-CLPB (ARP53790_P050) antibody is Catalog # AAP53790 (Previous Catalog # AAPP30852)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CLPB
Uniprot ID Q9H078
Protein Name Caseinolytic peptidase B protein homolog
Publications

Aggregating sequences that occur in many proteins constitute weak spots of bacterial proteostasis. Nat Commun. 9, 866 (2018). 29491361

Protein Accession # NP_110440
Purification Affinity Purified
Nucleotide Accession # NM_030813
Tested Species Reactivity Human
Gene Symbol CLPB
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 77%; Rabbit: 85%; Rat: 92%
Image 1
Human MCF-7
WB Suggested Anti-CLPB Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com