CLPB Antibody - N-terminal region (ARP53790_P050)

• Name: CLPB Antibody - N-terminal region (ARP53790_P050)
• Protein Size (# AA): 707 amino acids
• Molecular Weight: 78kDa
• NCBI Gene Id: 81570
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ClpB caseinolytic peptidase B homolog (E. coli)
• Description:
  View product citations for CLPB Antibody - N-terminal region (ARP53790_P050) on CiteAb
• Alias Symbols: SKD3, HSP78, MGCA7, ANKCLB, MEGCANN
• Peptide Sequence: Synthetic peptide located within the following region: QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Colland,F., (2004) Genome Res. 14 (7), 1324-1332
• Description of Target: CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.
• Protein Interactions: CEP70; IRS4; UBC; HDAC11; MDFI; SMAD9; CUL3; TERF2; UCHL3; OSBPL10; USP30; COPS6; TTF2;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-CLPB (ARP53790_P050) antibody is Catalog # AAP53790 (Previous Catalog # AAPP30852)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CLPB
• Uniprot ID: Q9H078
• Protein Name: Caseinolytic peptidase B protein homolog
• Publications:

  Ladan Khodaparast, Laleh Khodaparast, Rodrigo Gallardo, Nikolaos N Louros, Emiel Michiels, Reshmi Ramakrishnan, Meine Ramakers, Filip Claes, Lydia Young, Mohammad Shahrooei, Hannah Wilkinson, Matyas Desager, Wubishet Mengistu Tadesse, K Peter R Nilsson, Per Hammarstrm, Abram Aertsen, Sebastien Carpentier, Johan Van Eldere, Frederic Rousseau, Joost Schymkowitz. Aggregating sequences that occur in many proteins constitute weak spots of bacterial proteostasis.. Nat Commun. 9, 866 (2018). WB 29491361

• Protein Accession #: NP_110440
• Purification: Affinity Purified
• Nucleotide Accession #: NM_030813
• Tested Species Reactivity: Human
• Gene Symbol: CLPB
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 77%; Rabbit: 85%; Rat: 92%
• Image 1: Human MCF-7
  
  WB Suggested Anti-CLPB Antibody Titration: 0.2-1 ug/ml
  Positive Control: MCF7 cell lysate