CLMN Antibody - C-terminal region (ARP53774_P050)

Data Sheet
 
Product Number ARP53774_P050
Product Page www.avivasysbio.com/clmn-antibody-c-terminal-region-arp53774-p050.html
Name CLMN Antibody - C-terminal region (ARP53774_P050)
Protein Size (# AA) 1002 amino acids
Molecular Weight 110kDa
NCBI Gene Id 79789
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Calmin (calponin-like, transmembrane)
Alias Symbols FLJ12383, KIAA1188
Peptide Sequence Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Heilig,R., (2003) Nature 421 (6923), 601-607
Description of Target CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.
Protein Interactions PPP1CC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CLMN (ARP53774_P050) antibody
Blocking Peptide For anti-CLMN (ARP53774_P050) antibody is Catalog # AAP53774 (Previous Catalog # AAPP30616)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human CLMN
Uniprot ID Q96JQ2
Protein Name Calmin
Protein Accession # NP_079010
Purification Affinity Purified
Nucleotide Accession # NM_024734
Tested Species Reactivity Human
Gene Symbol CLMN
Predicted Species Reactivity Human, Mouse, Cow, Dog, Pig, Yeast
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 77%; Dog: 77%; Human: 100%; Mouse: 77%; Pig: 85%; Yeast: 92%
Image 1
Human Liver
WB Suggested Anti-CLMN Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com