Product Number |
ARP53774_P050 |
Product Page |
www.avivasysbio.com/clmn-antibody-c-terminal-region-arp53774-p050.html |
Name |
CLMN Antibody - C-terminal region (ARP53774_P050) |
Protein Size (# AA) |
1002 amino acids |
Molecular Weight |
110kDa |
NCBI Gene Id |
79789 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Calmin (calponin-like, transmembrane) |
Alias Symbols |
FLJ12383, KIAA1188 |
Peptide Sequence |
Synthetic peptide located within the following region: LEENVTKESISSKKKEKRKHVDHVESSLFVAPGSVQSSDDLEEDSSDYSI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Heilig,R., (2003) Nature 421 (6923), 601-607 |
Description of Target |
CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown. |
Protein Interactions |
PPP1CC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CLMN (ARP53774_P050) antibody |
Blocking Peptide |
For anti-CLMN (ARP53774_P050) antibody is Catalog # AAP53774 (Previous Catalog # AAPP30616) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CLMN |
Uniprot ID |
Q96JQ2 |
Protein Name |
Calmin |
Protein Accession # |
NP_079010 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024734 |
Tested Species Reactivity |
Human |
Gene Symbol |
CLMN |
Predicted Species Reactivity |
Human, Mouse, Cow, Dog, Pig, Yeast |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 77%; Dog: 77%; Human: 100%; Mouse: 77%; Pig: 85%; Yeast: 92% |
Image 1 | Human Liver
| WB Suggested Anti-CLMN Antibody Titration: 0.2-1 ug/ml Positive Control: Human Liver |
|
|