Product Number |
ARP53762_P050 |
Product Page |
www.avivasysbio.com/c17orf39-antibody-c-terminal-region-arp53762-p050.html |
Name |
C17orf39 Antibody - C-terminal region (ARP53762_P050) |
Protein Size (# AA) |
300 amino acids |
Molecular Weight |
34 kDa |
NCBI Gene Id |
79018 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Chromosome 17 open reading frame 39 |
Alias Symbols |
VID2, VID24, C17orf39 |
Peptide Sequence |
Synthetic peptide located within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Bi,W., (2002) Genome Res. 12 (5), 713-728 |
Description of Target |
The exact function of C17orf39 remains unknown. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Enhanced Validation |
|
Datasheets/Manuals |
Printable datasheet for anti-GID4 (ARP53762_P050) antibody |
Blocking Peptide |
For anti-GID4 (ARP53762_P050) antibody is Catalog # AAP53762 (Previous Catalog # AAPP30604) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf39 |
Uniprot ID |
Q8IVV7 |
Protein Name |
Glucose-induced degradation protein 4 homolog |
Protein Accession # |
NP_076957 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_024052 |
Tested Species Reactivity |
Human |
Gene Symbol |
GID4 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Muscle
| WB Suggested Anti-C17orf39 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Muscle |
|
|