C17orf39 Antibody - C-terminal region (ARP53762_P050)

Data Sheet
 
Product Number ARP53762_P050
Product Page www.avivasysbio.com/c17orf39-antibody-c-terminal-region-arp53762-p050.html
Name C17orf39 Antibody - C-terminal region (ARP53762_P050)
Protein Size (# AA) 300 amino acids
Molecular Weight 34 kDa
NCBI Gene Id 79018
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chromosome 17 open reading frame 39
Alias Symbols VID2, VID24, C17orf39
Peptide Sequence Synthetic peptide located within the following region: SFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Bi,W., (2002) Genome Res. 12 (5), 713-728
Description of Target The exact function of C17orf39 remains unknown. The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-GID4 (ARP53762_P050) antibody
Blocking Peptide For anti-GID4 (ARP53762_P050) antibody is Catalog # AAP53762 (Previous Catalog # AAPP30604)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human C17orf39
Uniprot ID Q8IVV7
Protein Name Glucose-induced degradation protein 4 homolog
Protein Accession # NP_076957
Purification Affinity Purified
Nucleotide Accession # NM_024052
Tested Species Reactivity Human
Gene Symbol GID4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Muscle
WB Suggested Anti-C17orf39 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com