Product Number |
ARP53733_P050 |
Product Page |
www.avivasysbio.com/spaca9-antibody-c-terminal-region-arp53733-p050.html |
Name |
SPACA9 Antibody - C-terminal region (ARP53733_P050) |
Protein Size (# AA) |
168 amino acids |
Molecular Weight |
18kDa |
NCBI Gene Id |
69987 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
sperm acrosome associated 9 |
Alias Symbols |
Ma, MAST, 1700026L06Rik |
Peptide Sequence |
Synthetic peptide located within the following region: VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SPACA9 (ARP53733_P050) antibody |
Blocking Peptide |
For anti-SPACA9 (ARP53733_P050) antibody is Catalog # AAP53733 |
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 1700026L06Rik |
Uniprot ID |
Q7TPM5 |
Protein Name |
sperm acrosome-associated protein 9 |
Protein Accession # |
NP_081559 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_027283 |
Tested Species Reactivity |
Mouse |
Gene Symbol |
SPACA9 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Mouse Testis
| Host: Rabbit Target Name: 1700026L06Rik Sample Type: Mouse Testis lysates Antibody Dilution: 1.0ug/ml |
|
|