SPACA9 Antibody - C-terminal region (ARP53733_P050)

Data Sheet
 
Product Number ARP53733_P050
Product Page www.avivasysbio.com/spaca9-antibody-c-terminal-region-arp53733-p050.html
Name SPACA9 Antibody - C-terminal region (ARP53733_P050)
Protein Size (# AA) 168 amino acids
Molecular Weight 18kDa
NCBI Gene Id 69987
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name sperm acrosome associated 9
Alias Symbols Ma, MAST, 1700026L06Rik
Peptide Sequence Synthetic peptide located within the following region: VTNSLLEKCKTLVSQSNDLSSLRAKYPHEVVNHLSCDEARNHYGGVVSLI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SPACA9 (ARP53733_P050) antibody
Blocking Peptide For anti-SPACA9 (ARP53733_P050) antibody is Catalog # AAP53733
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 1700026L06Rik
Uniprot ID Q7TPM5
Protein Name sperm acrosome-associated protein 9
Protein Accession # NP_081559
Purification Affinity Purified
Nucleotide Accession # NM_027283
Tested Species Reactivity Mouse
Gene Symbol SPACA9
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Mouse Testis
Host: Rabbit
Target Name: 1700026L06Rik
Sample Type: Mouse Testis lysates
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com