| Product Number |
ARP53731_P050 |
| Product Page |
www.avivasysbio.com/tcp11-antibody-middle-region-arp53731-p050.html |
| Name |
TCP11 Antibody - middle region (ARP53731_P050) |
| Protein Size (# AA) |
441 amino acids |
| Molecular Weight |
49kDa |
| NCBI Gene Id |
6954 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
T-complex 11 homolog (mouse) |
| Alias Symbols |
FPPR, D6S230E |
| Peptide Sequence |
Synthetic peptide located within the following region: DMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ma,Y.X., (2003) Zhongguo Yi Xue Ke Xue Yuan Xue Bao 25 (2), 122-128 |
| Description of Target |
TCP11 may play an important role in sperm function and fertility. |
| Protein Interactions |
APP; VAV2; IKBKG; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TCP11 (ARP53731_P050) antibody |
| Blocking Peptide |
For anti-TCP11 (ARP53731_P050) antibody is Catalog # AAP53731 (Previous Catalog # AAPP30571) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human TCP11 |
| Uniprot ID |
Q8WWU5-2 |
| Protein Name |
T-complex protein 11 homolog |
| Protein Accession # |
NP_061149 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_018679 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TCP11 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human DU145
 | WB Suggested Anti-TCP11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: DU145 cell lysate |
|
|
