| Product Number |
ARP53699_P050 |
| Product Page |
www.avivasysbio.com/c20orf10-antibody-middle-region-arp53699-p050.html |
| Name |
C20orf10 Antibody - middle region (ARP53699_P050) |
| Protein Size (# AA) |
290 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
27296 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
TP53 target 5 |
| Alias Symbols |
CLG01, C20orf10 |
| Peptide Sequence |
Synthetic peptide located within the following region: TSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Deloukas,P., (2001) Nature 414 (6866), 865-871 |
| Description of Target |
The exact function of C20orf10 remains unknown. |
| Protein Interactions |
APP; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-TP53TG5 (ARP53699_P050) antibody |
| Blocking Peptide |
For anti-TP53TG5 (ARP53699_P050) antibody is Catalog # AAP53699 (Previous Catalog # AAPP30541) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C20orf10 |
| Uniprot ID |
Q9Y2B4 |
| Protein Name |
TP53-target gene 5 protein |
| Protein Accession # |
NP_055292 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_014477 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
TP53TG5 |
| Predicted Species Reactivity |
Human, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 90%; Human: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-C20orf10 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T |
|
|
