| Product Number |
ARP53683_P050 |
| Product Page |
https://www.avivasysbio.com/stag3-antibody-middle-region-arp53683-p050.html |
| Name |
STAG3 Antibody - middle region (ARP53683_P050) |
| Protein Size (# AA) |
1225 amino acids |
| Molecular Weight |
135kDa |
| Subunit |
SA-3 |
| NCBI Gene Id |
10734 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Stromal antigen 3 |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Barber,T.D., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (9), 3443-3448 |
| Description of Target |
STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I. |
| Protein Interactions |
SMC3; SMC1A; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-STAG3 (ARP53683_P050) antibody |
| Blocking Peptide |
For anti-STAG3 (ARP53683_P050) antibody is Catalog # AAP53683 (Previous Catalog # AAPP30525) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human STAG3 |
| Uniprot ID |
Q9UJ98 |
| Protein Name |
Cohesin subunit SA-3 |
| Sample Type Confirmation |
STAG3 is supported by BioGPS gene expression data to be expressed in 721_B |
| Protein Accession # |
NP_036579 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_012447 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
STAG3 |
| Predicted Species Reactivity |
Human, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100%; Zebrafish: 83% |
| Image 1 | Human 721_B
 | WB Suggested Anti-STAG3 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysateSTAG3 is supported by BioGPS gene expression data to be expressed in 721_B |
|
|
