ACTL7B Antibody - middle region (ARP53662_P050)

• Product Number: ARP53662_P050
• Name: ACTL7B Antibody - middle region (ARP53662_P050)
• Protein Size (# AA): 416 amino acids
• Molecular Weight: 46kDa
• NCBI Gene Id: 10880
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Actin-like 7B
• Alias Symbols: Tact1
• Peptide Sequence: Synthetic peptide located within the following region: KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Humphray,S.J., (2004) Nature 429 (6990), 369-374
• Description of Target: ACTL7B is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.
• Protein Interactions: APP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ACTL7B (ARP53662_P050) antibody is Catalog # AAP53662 (Previous Catalog # AAPP30504)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACTL7B
• Uniprot ID: Q9Y614
• Protein Name: Actin-like protein 7B
• Protein Accession #: NP_006677
• Purification: Affinity Purified
• Nucleotide Accession #: NM_006686
• Tested Species Reactivity: Human
• Gene Symbol: ACTL7B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 77%; Dog: 83%; Human: 100%; Mouse: 85%; Rat: 92%
• Image 1: Transfected 293T
  
  WB Suggested Anti-ACTL7B Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Transfected 293T