NUP98 Antibody - N-terminal region (ARP53631_P050)

• Product Number: ARP53631_P050
• Name: NUP98 Antibody - N-terminal region (ARP53631_P050)
• Protein Size (# AA): 937 amino acids
• Molecular Weight: 98kDa
• NCBI Gene Id: 4928
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Nucleoporin 98kDa
• Alias Symbols: ADIR2, NUP96, NUP196, Nup98-96
• Peptide Sequence: Synthetic peptide located within the following region: EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Pan,Q., (2008) Oncogene 27 (24), 3414-3423
• Description of Target: The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kD nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kD nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL). This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Signal-mediated nuclear import and export proceed through the nuclear pore complex (NPC), which is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kD nucleoporin is generated through a biogenesis pathway that involves synthesis and proteolytic cleavage of a 186 kD precursor protein. This cleavage results in the 98 kD nucleoporin as well as a 96 kD nucleoporin, both of which are localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kD nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL). This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.
• Protein Interactions: UBC; SUMO2; SUMO3; CDC37; EED; CDC73; PAF1; ARFGEF2; FBXO6; NXF1; HDAC11; HDAC8; LMNA; HNRNPUL1; CSNK2A1; ECT2; NUP107; RAE1; SUMO1; NUMA1; rev; SIRT7; RAPGEF3; CTNNB1; NUP88; NUP159; NUP82; Nup98; Nup214; Nup188; tat; HDAC1; CREBBP; PTTG1; APC; NPM1; USP
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NUP98 (ARP53631_P050) antibody is Catalog # AAP53631 (Previous Catalog # AAPP30801)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NUP98
• Uniprot ID: A8KA17
• Protein Name: cDNA FLJ77211, highly similar to Homo sapiens nucleoporin 98kDa (NUP98), transcript variant 3, mRNA EMBL BAF85571.1
• Protein Accession #: NP_005378
• Purification: Affinity Purified
• Nucleotide Accession #: NM_005387
• Tested Species Reactivity: Human
• Gene Symbol: NUP98
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
• Image 1: Human Lung
  
  WB Suggested Anti-NUP98 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Human Lung