| Product Number |
ARP53629_P050 |
| Product Page |
https://www.avivasysbio.com/cdkn3-antibody-c-terminal-region-arp53629-p050.html |
| Name |
CDKN3 Antibody - C-terminal region (ARP53629_P050) |
| Protein Size (# AA) |
212 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
1033 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cyclin-dependent kinase inhibitor 3 |
| Alias Symbols |
KAP, CDI1, CIP2, KAP1 |
| Peptide Sequence |
Synthetic peptide located within the following region: CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Okamoto,K., (2006) Biochem. Biophys. Res. Commun. 351 (1), 216-222 |
| Description of Target |
CDKN3 belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. The protein encoded by this gene belongs to the dual specificity protein phosphatase family. It was identified as a cyclin-dependent kinase inhibitor, and has been shown to interact with, and dephosphorylate CDK2 kinase, thus prevent the activation of CDK2 kinase. This gene was reported to be deleted, mutated, or overexpressed in several kinds of cancers. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
CDK2; UBC; NCOA3; MS4A3; CDKN3; CDK3; CDC25A; CDK1; CEBPA; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CDKN3 (ARP53629_P050) antibody |
| Blocking Peptide |
For anti-CDKN3 (ARP53629_P050) antibody is Catalog # AAP53629 (Previous Catalog # AAPP30469) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human CDKN3 |
| Uniprot ID |
Q16667 |
| Protein Name |
Cyclin-dependent kinase inhibitor 3 |
| Protein Accession # |
NP_005183 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_005192 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CDKN3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 92% |
| Image 1 | Human Lung
 | WB Suggested Anti-CDKN3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung |
|
|
