| Product Number |
ARP53615_P050-HRP |
| Product Page |
www.avivasysbio.com/pdxk-antibody-n-terminal-region-hrp-arp53615-p050-hrp.html |
| Name |
PDXK Antibody - N-terminal region : HRP (ARP53615_P050-HRP) |
| Protein Size (# AA) |
312 amino acids |
| Molecular Weight |
34kDa |
| Conjugation |
HRP: Horseradish Peroxidase |
| NCBI Gene Id |
8566 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Pyridoxal (pyridoxine, vitamin B6) kinase |
| Alias Symbols |
PKH, PNK, HMSN6C, PRED79, C21orf97, HEL-S-1a, C21orf124 |
| Peptide Sequence |
Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK |
| Product Format |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Reference |
Musayev,F.N., (2007) Protein Sci. 16 (10), 2184-2194 |
| Description of Target |
PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Protein Interactions |
UBC; SUMO1; NEDD8; YWHAQ; BARD1; CAND1; COPS5; CUL1; CUL3; ELAVL1; |
| Reconstitution and Storage |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Datasheets/Manuals |
Printable datasheet for anti-PDXK (ARP53615_P050-HRP) antibody |
| Blocking Peptide |
For anti-PDXK (ARP53615_P050-HRP) antibody is Catalog # AAP53615 (Previous Catalog # AAPP30455) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human PDXK |
| Uniprot ID |
O00764 |
| Protein Name |
Pyridoxal kinase |
| Protein Accession # |
NP_003672 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003681 |
| Gene Symbol |
PDXK |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 92%; Sheep: 100% |
| Image 1 | |
|
