PDXK Antibody - N-terminal region (ARP53615_P050)

• Product Number: ARP53615_P050
• Name: PDXK Antibody - N-terminal region (ARP53615_P050)
• Protein Size (# AA): 312 amino acids
• Molecular Weight: 34kDa
• NCBI Gene Id: 8566
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Pyridoxal (pyridoxine, vitamin B6) kinase
• Alias Symbols: PKH, PNK, HMSN6C, PRED79, C21orf97, HEL-S-1a, C21orf124
• Peptide Sequence: Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Musayev,F.N., (2007) Protein Sci. 16 (10), 2184-2194
• Description of Target: PDXK phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. PDXK is cytoplasmic and probably acts as a homodimer. The protein encoded by this gene phosphorylates vitamin B6, a step required for the conversion of vitamin B6 to pyridoxal-5-phosphate, an important cofactor in intermediary metabolism. The encoded protein is cytoplasmic and probably acts as a homodimer. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; SUMO1; NEDD8; YWHAQ; BARD1; CAND1; COPS5; CUL1; CUL3; ELAVL1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PDXK (ARP53615_P050) antibody is Catalog # AAP53615 (Previous Catalog # AAPP30455)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDXK
• Uniprot ID: O00764
• Protein Name: Pyridoxal kinase
• Protein Accession #: NP_003672
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003681
• Tested Species Reactivity: Human
• Gene Symbol: PDXK
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Application: WB, IHC
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 79%; Rabbit: 86%; Rat: 92%; Sheep: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-PDXK Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human Adult Placenta
  
  Host: Rabbit
  Target Name: SERPINA3
  Sample Type: Human Adult Placenta
  Antibody Dilution: 1.0ug/ml
• Image 3: Human Fetal Brain
  
  Host: Rabbit
  Target Name: NOP56
  Sample Type: Human Fetal Brain
  Antibody Dilution: 1.0ug/ml
• Image 4: Human Lung Tissue
  
  PDXK antibody - N-terminal region (ARP53615_P050)
  Catalog Number: ARP53615_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue
  Observed Staining: Cytoplasm of pneumocytes
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec
• Image 5: Human Bronchial Epithelial Tissue
  
  PDXK antibody - N-terminal region (ARP53615_P050)
  Catalog Number: ARP53615_P050
  Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue
  Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue
  Primary Antibody Concentration: 1:100
  Secondary Antibody: Donkey anti-Rabbit-Cy3
  Secondary Antibody Concentration: 1:200
  Magnification: 20X
  Exposure Time: 0.5 - 2.0 sec