| Product Number |
ARP53611_P050 |
| Product Page |
www.avivasysbio.com/dnali1-antibody-n-terminal-region-arp53611-p050.html |
| Name |
DNALI1 Antibody - N-terminal region (ARP53611_P050) |
| Protein Size (# AA) |
280 amino acids |
| Molecular Weight |
31kDa |
| NCBI Gene Id |
7802 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Dynein, axonemal, light intermediate chain 1 |
| Alias Symbols |
P28, hp28, dJ423B22.5 |
| Peptide Sequence |
Synthetic peptide located within the following region: MVTANKAHTGQGSCWVATLASAMIPPADSLLKYDTPVLVSRNTEKRSPKA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Combs,J., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (40), 14883-14888 |
| Description of Target |
DNALI1 is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. This gene is the human homolog of the Chlamydomonas inner dynein arm gene, p28. The precise function of this gene is not known, however, it is a potential candidate for immotile cilia syndrome (ICS). Ultrastructural defects of the inner dynein arms are seen in patients with ICS. Immotile mutant strains of Chlamydomonas, a biflagellated algae, exhibit similar defects. |
| Protein Interactions |
SIAH1; PRMT6; APP; DNALI1; HTT; ABCF3; EPS8; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-DNALI1 (ARP53611_P050) antibody |
| Blocking Peptide |
For anti-DNALI1 (ARP53611_P050) antibody is Catalog # AAP53611 (Previous Catalog # AAPP30451) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DNALI1 |
| Uniprot ID |
O14645 |
| Protein Name |
Axonemal dynein light intermediate polypeptide 1 |
| Protein Accession # |
NP_003453 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003462 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
DNALI1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human nasal epithelial
 | Application: IHC
Species+tissue/cell type:Human nasal epithelial cells
Primary antibody dilution: 1:1000
Secondary antibody: Goat anti-rabbit Alexa Fluor 546
Secondary antibody dilution:1:1000 - See more at: http://www.avivasysbio.com/dnali1-antibody-n-terminal-region-arp53611-p050.html#sthash.SFTiXW2a.dpuf |
|
| Image 2 | Transfected 293T
 | WB Suggested Anti-DNALI1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T |
|
