| Product Number |
ARP53590_P050 |
| Product Page |
www.avivasysbio.com/acrv1-antibody-n-terminal-region-arp53590-p050.html |
| Name |
ACRV1 Antibody - N-terminal region (ARP53590_P050) |
| Protein Size (# AA) |
265 amino acids |
| Molecular Weight |
29kDa |
| NCBI Gene Id |
56 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Acrosomal vesicle protein 1 |
| Alias Symbols |
SP-10, SPACA2, D11S4365 |
| Peptide Sequence |
Synthetic peptide located within the following region: MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Reddi,P.P., J. Reprod. Immunol. 53 (1-2), 25-36 (2002) |
| Description of Target |
ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. This gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. This gene consists of 4 exons and its alternative splicing generates multiple distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ACRV1 (ARP53590_P050) antibody |
| Blocking Peptide |
For anti-ACRV1 (ARP53590_P050) antibody is Catalog # AAP53590 (Previous Catalog # AAPP31111) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ACRV1 |
| Uniprot ID |
P26436 |
| Protein Name |
Acrosomal protein SP-10 |
| Protein Accession # |
NP_001603 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001612 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ACRV1 |
| Predicted Species Reactivity |
Human, Guinea Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Guinea Pig: 79%; Human: 100%; Rabbit: 85% |
| Image 1 | Human Liver
 | WB Suggested Anti-ACRV1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver |
|
|
