ADAM2 Antibody - N-terminal region (ARP53588_P050)

• Product Number: ARP53588_P050
• Name: ADAM2 Antibody - N-terminal region (ARP53588_P050)
• Protein Size (# AA): 735 amino acids
• Molecular Weight: 81kDa
• NCBI Gene Id: 2515
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: ADAM metallopeptidase domain 2
• Alias Symbols: CT15, FTNB, PH30, CRYN1, CRYN2, PH-30b, PH30-beta
• Peptide Sequence: Synthetic peptide located within the following region: NFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.
• Protein Interactions: DNM1; CRYAB; CLGN; CD9;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ADAM2 (ARP53588_P050) antibody is Catalog # AAP53588
• Uniprot ID: Q99965
• Protein Name: Disintegrin and metalloproteinase domain-containing protein 2
• Protein Accession #: NP_001455
• Purification: Affinity Purified
• Nucleotide Accession #: NM_001464
• Tested Species Reactivity: Human
• Gene Symbol: ADAM2
• Predicted Species Reactivity: Human, Rat, Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Pig: 79%; Rat: 79%
• Image 1: Human Fetal Skin
  
  WB Suggested Anti-ADAM2 Antibody
  Titration: 1.0 ug/ml
  Positive Control: Fetal Skin