| Product Number |
ARP53580_P050 |
| Product Page |
https://www.avivasysbio.com/crisp1-antibody-n-terminal-region-arp53580-p050.html |
| Name |
CRISP1 Antibody - N-terminal region (ARP53580_P050) |
| Protein Size (# AA) |
249 amino acids |
| Molecular Weight |
27kDa |
| NCBI Gene Id |
167 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cysteine-rich secretory protein 1 |
| Alias Symbols |
ARP, AEGL1, HUMARP, CRISP-1, HEL-S-57, HSCRISP1D, HSCRISP1G |
| Peptide Sequence |
Synthetic peptide located within the following region: LKMSWSEEAAQNARIFSKYCDMTESNPLERRLPNTFCGENMHMTSYPVSW |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mungall,A.J., (2003) Nature 425 (6960), 805-811 |
| Description of Target |
Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. CRISP1 is a member of the cysteine-rich secretory protein (CRISP) family. It is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface.Fertilization consists of a sequence of specific cell-cell interactions culminating in the fusion of the sperm and egg plasma membranes. Recognition, binding, and fusion occur through the interaction of complementary molecules that are localized to specific domains of the sperm and egg plasma membranes. In the sperm, the postacrosomal region or equatorial segment is involved in sperm-egg plasma membrane fusion. The protein encoded by this gene is a member of the cysteine-rich secretory protein (CRISP) family. This protein is expressed in the epididymis, is secreted into the epididymal lumen, and binds to the postacrosomal region of the sperm head where it plays a role at fertilization in sperm-egg fusion through complementary sites localized on the egg surface. Two isoforms are encoded by transcript variants of this gene. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CRISP1 (ARP53580_P050) antibody |
| Blocking Peptide |
For anti-CRISP1 (ARP53580_P050) antibody is Catalog # AAP53580 (Previous Catalog # AAPS32908) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CRISP1 |
| Uniprot ID |
P54107 |
| Protein Name |
Cysteine-rich secretory protein 1 |
| Protein Accession # |
NP_001122 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001131 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CRISP1 |
| Predicted Species Reactivity |
Human, Cow, Dog, Goat, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 85%; Dog: 85%; Goat: 85%; Human: 100%; Pig: 85%; Rabbit: 79%; Zebrafish: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-CRISP1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate |
|
