IL13RA2 Antibody - middle region (ARP53558_P050)

• Product Number: ARP53558_P050
• Name: IL13RA2 Antibody - middle region (ARP53558_P050)
• Protein Size (# AA): 380 amino acids
• Molecular Weight: 44 kDa
• Subunit: alpha-2
• NCBI Gene Id: 3598
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Interleukin 13 receptor, alpha 2
• Alias Symbols: CT19, IL-13R, IL13BP, CD213A2
• Peptide Sequence: Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Katsoulotos,G.P., (2008) J. Biol. Chem. 283 (3), 1610-1621
• Description of Target: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; IL4; IL13;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-IL13RA2 (ARP53558_P050) antibody is Catalog # AAP53558 (Previous Catalog # AAPS32710)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL13RA2
• Uniprot ID: Q14627
• Protein Name: Interleukin-13 receptor subunit alpha-2
• Protein Accession #: NP_000631
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000640
• Tested Species Reactivity: Human
• Gene Symbol: IL13RA2
• Predicted Species Reactivity: Human, Rat, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%; Rabbit: 79%; Rat: 79%
• Image 1: Human HepG2
  
  WB Suggested Anti-IL13RA2 Antibody Titration: 0.2-1 ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
  
  25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment. The protein may be modified by glycosylation.